Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [142371] (2 PDB entries) |
Domain d2ggta1: 2ggt A:138-297 [135156] automatically matched to 1WP0 A:138-297 complexed with cl, ni |
PDB Entry: 2ggt (more details), 2.4 Å
SCOP Domain Sequences for d2ggta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggta1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} gpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdlt plfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededyi vdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy
Timeline for d2ggta1: