SCOP 1.73: Domain d2ggta1: 2ggt A:138-297

Lineage for d2ggta1 (2ggt A:138-297)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)

6. Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142371] (2 PDB entries)

8. Domain d2ggta1: 2ggt A:138-297 [135156]
   automatically matched to 1WP0 A:138-297
   complexed with cl, ni

Details for d2ggta1

PDB Entry: 2ggt, 2.4 Å

PDB Description: Crystal structure of human SCO1 complexed with nickel.

PDB Compounds: (A:) SCO1 protein homolog, mitochondrial

SCOP Domain Sequences for d2ggta1:

Sequence; same for both SEQRES and ATOM records:

>d2ggta1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]}
gpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdlt
plfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededyi
vdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy

Timeline for d2ggta1:

• d2ggta1 is new in SCOP 1.73
  
• d2ggta1 appears in SCOP 1.75
  
• d2ggta1 appears in the current release, SCOPe 2.08, called d2ggta_