Lineage for d2ggta_ (2ggt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877814Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 2877828Species Human (Homo sapiens) [TaxId:9606] [142371] (2 PDB entries)
    Uniprot O75880 138-297
  8. 2877829Domain d2ggta_: 2ggt A: [135156]
    automated match to d1wp0a1
    complexed with cl, ni

Details for d2ggta_

PDB Entry: 2ggt (more details), 2.4 Å

PDB Description: Crystal structure of human SCO1 complexed with nickel.
PDB Compounds: (A:) SCO1 protein homolog, mitochondrial

SCOPe Domain Sequences for d2ggta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggta_ c.47.1.10 (A:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]}
llggpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlp
dltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdede
dyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyr

SCOPe Domain Coordinates for d2ggta_:

Click to download the PDB-style file with coordinates for d2ggta_.
(The format of our PDB-style files is described here.)

Timeline for d2ggta_: