SCOPe 2.08: Domain d2ggta_: 2ggt A:

Lineage for d2ggta_ (2ggt A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142371] (2 PDB entries)
   Uniprot O75880 138-297

8. Domain d2ggta_: 2ggt A: [135156]
   automated match to d1wp0a1
   complexed with cl, ni

Details for d2ggta_

PDB Entry: 2ggt, 2.4 Å

PDB Description: Crystal structure of human SCO1 complexed with nickel.

PDB Compounds: (A:) SCO1 protein homolog, mitochondrial

SCOPe Domain Sequences for d2ggta_:

Sequence; same for both SEQRES and ATOM records:

>d2ggta_ c.47.1.10 (A:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]}
llggpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlp
dltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdede
dyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyr

Timeline for d2ggta_:

• d2ggta_ first appeared in SCOP 1.73, called d2ggta1
  
• d2ggta_ appears in SCOPe 2.07