Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein Copper transporter domain ccc2a [64279] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (3 PDB entries) |
Domain d2ggpb1: 2ggp B:1-72 [135155] Other proteins in same PDB: d2ggpa1 automatically matched to d1fvqa_ complexed with cu1 |
PDB Entry: 2ggp (more details)
SCOPe Domain Sequences for d2ggpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie dcgfdceilrds
Timeline for d2ggpb1: