SCOP 1.73: Domain d2ggpb1: 2ggp B:1-72

Lineage for d2ggpb1 (2ggp B:1-72)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins)

6. Protein Copper transporter domain ccc2a [64279] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (3 PDB entries)

8. Domain d2ggpb1: 2ggp B:1-72 [135155]
   Other proteins in same PDB: d2ggpa1
   automatically matched to d1fvqa_
   complexed with cu1

Details for d2ggpb1

PDB Entry: 2ggp

PDB Description: solution structure of the atx1-cu(i)-ccc2a complex

PDB Compounds: (B:) Probable copper-transporting ATPase

SCOP Domain Sequences for d2ggpb1:

Sequence; same for both SEQRES and ATOM records:

>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds

Timeline for d2ggpb1:

• d2ggpb1 is new in SCOP 1.73
  
• d2ggpb1 appears in SCOP 1.75
  
• d2ggpb1 appears in the current release, SCOPe 2.08, called d2ggpb2