SCOPe 2.08: Domain d2ggpb2: 2ggp B:2-72

Lineage for d2ggpb2 (2ggp B:2-72)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Copper transporter domain ccc2a [64279] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64280] (3 PDB entries)

8. Domain d2ggpb2: 2ggp B:2-72 [135155]
   Other proteins in same PDB: d2ggpa_, d2ggpb3
   automated match to d2ggpb1
   complexed with cu1

Details for d2ggpb2

PDB Entry: 2ggp

PDB Description: solution structure of the atx1-cu(i)-ccc2a complex

PDB Compounds: (B:) Probable copper-transporting ATPase

SCOPe Domain Sequences for d2ggpb2:

Sequence; same for both SEQRES and ATOM records:

>d2ggpb2 d.58.17.1 (B:2-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
revilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiied
cgfdceilrds

Timeline for d2ggpb2:

• d2ggpb2 first appeared in SCOP 1.73, called d2ggpb1
  
• d2ggpb2 appears in SCOPe 2.07