Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries) |
Domain d2ggpa1: 2ggp A:1-73 [135154] Other proteins in same PDB: d2ggpb1 automatically matched to d1fd8a_ complexed with cu1 |
PDB Entry: 2ggp (more details)
SCOPe Domain Sequences for d2ggpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggpa1 d.58.17.1 (A:1-73) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki kktgkevrsgkql
Timeline for d2ggpa1: