Lineage for d2ggpa1 (2ggp A:1-73)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) 
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries) 
Domain d2ggpa1: 2ggp A:1-73 [135154]
Other proteins in same PDB: d2ggpb1
automatically matched to d1fd8a_
complexed with cu1
Details for d2ggpa1
PDB Entry: 2ggp (more details)
PDB Description: solution structure of the atx1-cu(i)-ccc2a complex
PDB Compounds: (A:) Metal homeostasis factor ATX1SCOPe Domain Sequences for d2ggpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggpa1 d.58.17.1 (A:1-73) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
kktgkevrsgkql
SCOPe Domain Coordinates for d2ggpa1:
Click to download the PDB-style file with coordinates for d2ggpa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ggpa1:
- d2ggpa1 first appeared in SCOP 1.73
- d2ggpa1 appears in SCOPe 2.02
- d2ggpa1 is called d2ggpa_ in SCOPe 2.04
- d2ggpa1 appears in the current release, SCOPe 2.08, called d2ggpa_
View in 3D
