Lineage for d2ggpa1 (2ggp A:1-73)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206509Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1206510Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1206511Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 1206512Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)
  8. 1206527Domain d2ggpa1: 2ggp A:1-73 [135154]
    Other proteins in same PDB: d2ggpb1
    automatically matched to d1fd8a_
    complexed with cu1

Details for d2ggpa1

PDB Entry: 2ggp (more details)

PDB Description: solution structure of the atx1-cu(i)-ccc2a complex
PDB Compounds: (A:) Metal homeostasis factor ATX1

SCOPe Domain Sequences for d2ggpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggpa1 d.58.17.1 (A:1-73) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
kktgkevrsgkql

SCOPe Domain Coordinates for d2ggpa1:

Click to download the PDB-style file with coordinates for d2ggpa1.
(The format of our PDB-style files is described here.)

Timeline for d2ggpa1: