![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
![]() | Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries) |
![]() | Domain d2ggpa_: 2ggp A: [135154] Other proteins in same PDB: d2ggpb2, d2ggpb3 automated match to d2ggpa1 complexed with cu1 |
PDB Entry: 2ggp (more details)
SCOPe Domain Sequences for d2ggpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggpa_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki kktgkevrsgkql
Timeline for d2ggpa_: