Lineage for d2ggmb1 (2ggm B:25-166)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 640930Protein Calmodulin [47516] (10 species)
  7. 640931Species African frog (Xenopus laevis) [TaxId:8355] [47521] (11 PDB entries)
  8. 640934Domain d2ggmb1: 2ggm B:25-166 [135153]
    automatically matched to d1cfc__
    complexed with ca

Details for d2ggmb1

PDB Entry: 2ggm (more details), 2.35 Å

PDB Description: Human centrin 2 xeroderma pigmentosum group C protein complex
PDB Compounds: (B:) Centrin-2

SCOP Domain Sequences for d2ggmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggmb1 a.39.1.5 (B:25-166) Calmodulin {African frog (Xenopus laevis) [TaxId: 8355]}
lteeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikkmiseidkegtgkm
nfgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelqe
mideadrdgdgevseqeflrim

SCOP Domain Coordinates for d2ggmb1:

Click to download the PDB-style file with coordinates for d2ggmb1.
(The format of our PDB-style files is described here.)

Timeline for d2ggmb1: