SCOP 1.73: Domain d2gglc1: 2ggl C:3-304

Lineage for d2gglc1 (2ggl C:3-304)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (2 families)
   Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases

5. Family d.160.1.2: Carbamilase [64433] (2 proteins)

6. Protein N-carbamoyl-D-aminoacid amidohydrolase [64434] (2 species)

7. Species Agrobacterium radiobacter [TaxId:358] [64436] (3 PDB entries)

8. Domain d2gglc1: 2ggl C:3-304 [135150]
   automatically matched to 2GGL A:3-304
   mutant

Details for d2gglc1

PDB Entry: 2ggl, 2.4 Å

PDB Description: the mutant a222c of agrobacterium radiobacter n-carbamoyl-d-amino acid amidohydrolase

PDB Compounds: (C:) N-carbamoyl-D-amino acid amidohydrolase

SCOP Domain Sequences for d2gglc1:

Sequence; same for both SEQRES and ATOM records:

>d2gglc1 d.160.1.2 (C:3-304) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium radiobacter [TaxId: 358]}
rqmilavgqqgpiaraetreqvvgrlldmltnaasrgvnfivfpelalttffprwhftde
aeldsfyetempgpvvrplfetaaelgigfnlgyaelvveggvkrrfntsilvdksgkiv
gkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmficndrrwpetwr
vmglkgaeiicggyntpthnppvpqhdhltsfhhllsmqcgsyqngawsaaagkvgmeeg
cmllghscivaptgeivaltttledevitaaldldrcrelrehifnfkahrqpqhyglia
ef

Timeline for d2gglc1:

• d2gglc1 is new in SCOP 1.73
  
• d2gglc1 appears in SCOP 1.75
  
• d2gglc1 appears in the current release, SCOPe 2.08, called d2gglc_