Lineage for d2ggkd_ (2ggk D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998496Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998497Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) (S)
    Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. 2998507Family d.160.1.2: Carbamilase [64433] (3 proteins)
  6. 2998520Protein N-carbamoyl-D-aminoacid amidohydrolase [64434] (2 species)
  7. 2998521Species Agrobacterium radiobacter [TaxId:358] [64436] (7 PDB entries)
  8. 2998533Domain d2ggkd_: 2ggk D: [135147]
    automated match to d1fo6a_
    mutant

Details for d2ggkd_

PDB Entry: 2ggk (more details), 2.3 Å

PDB Description: the mutant a302c of agrobacterium radiobacter n-carbamoyl-d-amino-acid amidohydrolase
PDB Compounds: (D:) N-carbamoyl-D-amino acid amidohydrolase

SCOPe Domain Sequences for d2ggkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggkd_ d.160.1.2 (D:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium radiobacter [TaxId: 358]}
rqmilavgqqgpiaraetreqvvgrlldmltnaasrgvnfivfpelalttffprwhftde
aeldsfyetempgpvvrplfetaaelgigfnlgyaelvveggvkrrfntsilvdksgkiv
gkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmficndrrwpetwr
vmglkgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkvgmeeg
cmllghscivaptgeivaltttledevitaaldldrcrelrehifnfkahrqpqhyglic
ef

SCOPe Domain Coordinates for d2ggkd_:

Click to download the PDB-style file with coordinates for d2ggkd_.
(The format of our PDB-style files is described here.)

Timeline for d2ggkd_: