Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein Hypothetical protein YitF [143248] (1 species) |
Species Bacillus subtilis [TaxId:1423] [143249] (2 PDB entries) Uniprot O06741 1-114 |
Domain d2ggef2: 2gge F:5-118 [135139] Other proteins in same PDB: d2ggea1, d2ggea3, d2ggea4, d2ggeb1, d2ggeb3, d2ggeb4, d2ggec1, d2ggec3, d2ggec4, d2gged1, d2gged3, d2gged4, d2ggee1, d2ggee3, d2ggee4, d2ggef1, d2ggef3, d2ggef4, d2ggeg1, d2ggeg3, d2ggeg4, d2ggeh1, d2ggeh3, d2ggeh4 automated match to d2gdqa2 complexed with cl, mg |
PDB Entry: 2gge (more details), 1.89 Å
SCOPe Domain Sequences for d2ggef2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggef2 d.54.1.1 (F:5-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} kivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgftk riipfllgkqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwgg
Timeline for d2ggef2:
View in 3D Domains from other chains: (mouse over for more information) d2ggea1, d2ggea2, d2ggea3, d2ggea4, d2ggeb1, d2ggeb2, d2ggeb3, d2ggeb4, d2ggec1, d2ggec2, d2ggec3, d2ggec4, d2gged1, d2gged2, d2gged3, d2gged4, d2ggee1, d2ggee2, d2ggee3, d2ggee4, d2ggeg1, d2ggeg2, d2ggeg3, d2ggeg4, d2ggeh1, d2ggeh2, d2ggeh3, d2ggeh4 |