Lineage for d2ggee2 (2gge E:5-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947742Protein Hypothetical protein YitF [143248] (1 species)
  7. 2947743Species Bacillus subtilis [TaxId:1423] [143249] (2 PDB entries)
    Uniprot O06741 1-114
  8. 2947750Domain d2ggee2: 2gge E:5-118 [135137]
    Other proteins in same PDB: d2ggea1, d2ggea3, d2ggea4, d2ggeb1, d2ggeb3, d2ggeb4, d2ggec1, d2ggec3, d2ggec4, d2gged1, d2gged3, d2gged4, d2ggee1, d2ggee3, d2ggee4, d2ggef1, d2ggef3, d2ggef4, d2ggeg1, d2ggeg3, d2ggeg4, d2ggeh1, d2ggeh3, d2ggeh4
    automated match to d2gdqa2
    complexed with cl, mg

Details for d2ggee2

PDB Entry: 2gge (more details), 1.89 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
PDB Compounds: (E:) yitF

SCOPe Domain Sequences for d2ggee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggee2 d.54.1.1 (E:5-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]}
kivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgftk
riipfllgkqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwgg

SCOPe Domain Coordinates for d2ggee2:

Click to download the PDB-style file with coordinates for d2ggee2.
(The format of our PDB-style files is described here.)

Timeline for d2ggee2: