Lineage for d2gged2 (2gge D:4-118)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722893Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 722894Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 722895Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 protein domains)
    C-terminal domain is beta/alpha-barrel
  6. 723023Protein Hypothetical protein YitF [143248] (1 species)
  7. 723024Species Bacillus subtilis [TaxId:1423] [143249] (2 PDB entries)
  8. 723030Domain d2gged2: 2gge D:4-118 [135135]
    Other proteins in same PDB: d2ggea1, d2ggeb1, d2ggec1, d2gged1, d2ggee1, d2ggef1, d2ggeg1, d2ggeh1
    automatically matched to 2GDQ A:4-118
    complexed with cl, mg

Details for d2gged2

PDB Entry: 2gge (more details), 1.89 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
PDB Compounds: (D:) yitF

SCOP Domain Sequences for d2gged2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gged2 d.54.1.1 (D:4-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]}
vkivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgft
kriipfllgkqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwgg

SCOP Domain Coordinates for d2gged2:

Click to download the PDB-style file with coordinates for d2gged2.
(The format of our PDB-style files is described here.)

Timeline for d2gged2: