Lineage for d2gged1 (2gge D:119-376)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. Protein Hypothetical protein YitF [141844] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [141845] (2 PDB entries)
    Uniprot O06741 115-371
  8. Domain d2gged1: 2gge D:119-376 [135134]
    Other proteins in same PDB: d2ggea2, d2ggea3, d2ggea4, d2ggeb2, d2ggeb3, d2ggeb4, d2ggec2, d2ggec3, d2ggec4, d2gged2, d2gged3, d2gged4, d2ggee2, d2ggee3, d2ggee4, d2ggef2, d2ggef3, d2ggef4, d2ggeg2, d2ggeg3, d2ggeg4, d2ggeh2, d2ggeh3, d2ggeh4
    automated match to d2gdqa1
    complexed with cl, mg

Details for d2gged1

PDB Entry: 2gge (more details), 1.8900000000000001 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
PDB Compounds: (D:) yitF

SCOPe Domain Sequences for d2gged1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gged1 c.1.11.2 (D:119-376) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]}
ryreeipvyasfqsysdspqwisrsvsnveaqlkkgfeqikvkiggtsfkedvrhinalq
htagssitmildanqsydaaaafkweryfsewtnigwleeplpfdqpqdyamlrsrlsvp
vaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdclqlaryfgvrasahaydgs
lsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvhipkgkgigte
inmeivnrykwdgsayeg

SCOPe Domain Coordinates for d2gged1 are not available.

Timeline for d2gged1:

Domains from same chain:
(mouse over for more information)
d2gged2, d2gged3, d2gged4