Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins) |
Protein Hypothetical protein YitF [141844] (1 species) |
Species Bacillus subtilis [TaxId:1423] [141845] (2 PDB entries) |
Domain d2ggec1: 2gge C:119-374 [135132] Other proteins in same PDB: d2ggea2, d2ggeb2, d2ggec2, d2gged2, d2ggee2, d2ggef2, d2ggeg2, d2ggeh2 automatically matched to 2GDQ A:119-374 complexed with cl, mg |
PDB Entry: 2gge (more details), 1.89 Å
SCOP Domain Sequences for d2ggec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggec1 c.1.11.2 (C:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} ryreeipvyasfqsysdspqwisrsvsnveaqlkkgfeqikvkiggtsfkedvrhinalq htagssitmildanqsydaaaafkweryfsewtnigwleeplpfdqpqdyamlrsrlsvp vaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdclqlaryfgvrasahaydgs lsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvhipkgkgigte inmeivnrykwdgsay
Timeline for d2ggec1: