Lineage for d2ggeb1 (2gge B:119-374)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099101Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2099159Protein Hypothetical protein YitF [141844] (1 species)
  7. 2099160Species Bacillus subtilis [TaxId:1423] [141845] (2 PDB entries)
    Uniprot O06741 115-371
  8. 2099164Domain d2ggeb1: 2gge B:119-374 [135130]
    Other proteins in same PDB: d2ggea2, d2ggea3, d2ggea4, d2ggeb2, d2ggeb3, d2ggeb4, d2ggec2, d2ggec3, d2ggec4, d2gged2, d2gged3, d2gged4, d2ggee2, d2ggee3, d2ggee4, d2ggef2, d2ggef3, d2ggef4, d2ggeg2, d2ggeg3, d2ggeg4, d2ggeh2, d2ggeh3, d2ggeh4
    automated match to d2gdqa1
    complexed with cl, mg

Details for d2ggeb1

PDB Entry: 2gge (more details), 1.89 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
PDB Compounds: (B:) yitF

SCOPe Domain Sequences for d2ggeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggeb1 c.1.11.2 (B:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]}
ryreeipvyasfqsysdspqwisrsvsnveaqlkkgfeqikvkiggtsfkedvrhinalq
htagssitmildanqsydaaaafkweryfsewtnigwleeplpfdqpqdyamlrsrlsvp
vaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdclqlaryfgvrasahaydgs
lsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvhipkgkgigte
inmeivnrykwdgsay

SCOPe Domain Coordinates for d2ggeb1:

Click to download the PDB-style file with coordinates for d2ggeb1.
(The format of our PDB-style files is described here.)

Timeline for d2ggeb1: