SCOP 1.73: Domain d2ggeb1: 2gge B:119-374

Lineage for d2ggeb1 (2gge B:119-374)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)

6. Protein Hypothetical protein YitF [141844] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [141845] (2 PDB entries)

8. Domain d2ggeb1: 2gge B:119-374 [135130]
   Other proteins in same PDB: d2ggea2, d2ggeb2, d2ggec2, d2gged2, d2ggee2, d2ggef2, d2ggeg2, d2ggeh2
   automatically matched to 2GDQ A:119-374
   complexed with cl, mg

Details for d2ggeb1

PDB Entry: 2gge, 1.89 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a

PDB Compounds: (B:) yitF

SCOP Domain Sequences for d2ggeb1:

Sequence; same for both SEQRES and ATOM records:

>d2ggeb1 c.1.11.2 (B:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]}
ryreeipvyasfqsysdspqwisrsvsnveaqlkkgfeqikvkiggtsfkedvrhinalq
htagssitmildanqsydaaaafkweryfsewtnigwleeplpfdqpqdyamlrsrlsvp
vaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdclqlaryfgvrasahaydgs
lsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvhipkgkgigte
inmeivnrykwdgsay

Timeline for d2ggeb1:

• d2ggeb1 is new in SCOP 1.73
  
• d2ggeb1 appears in SCOP 1.75
  
• d2ggeb1 appears in the current release, SCOPe 2.08