Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
Protein Hypothetical protein YitF [143248] (1 species) |
Species Bacillus subtilis [TaxId:1423] [143249] (2 PDB entries) |
Domain d2ggea2: 2gge A:4-118 [135129] Other proteins in same PDB: d2ggea1, d2ggeb1, d2ggec1, d2gged1, d2ggee1, d2ggef1, d2ggeg1, d2ggeh1 automatically matched to 2GDQ A:4-118 complexed with cl, mg |
PDB Entry: 2gge (more details), 1.89 Å
SCOP Domain Sequences for d2ggea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggea2 d.54.1.1 (A:4-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} vkivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgft kriipfllgkqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwgg
Timeline for d2ggea2: