Lineage for d2ggca1 (2ggc A:3-264)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872162Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 872163Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 872164Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 872219Protein Methionine aminopeptidase [55924] (5 species)
  7. 872228Species Escherichia coli [TaxId:562] [55925] (38 PDB entries)
    Uniprot P07906
  8. 872230Domain d2ggca1: 2ggc A:3-264 [135127]
    automatically matched to d1mat__
    complexed with co, met, na

Details for d2ggca1

PDB Entry: 2ggc (more details), 1 Å

PDB Description: Novel bacterial methionine aminopeptidase inhibitors
PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d2ggca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggca1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
isiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgy
hgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimg
erlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepq
vlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtd
ngceiltlrkddtipaiishde

SCOP Domain Coordinates for d2ggca1:

Click to download the PDB-style file with coordinates for d2ggca1.
(The format of our PDB-style files is described here.)

Timeline for d2ggca1: