Lineage for d2ggba_ (2ggb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214036Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2214037Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2214038Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2214087Protein Methionine aminopeptidase [55924] (6 species)
  7. 2214088Species Escherichia coli K-12 [TaxId:83333] [187115] (9 PDB entries)
  8. 2214096Domain d2ggba_: 2ggb A: [135126]
    automated match to d1mat__
    complexed with co, na, u17

Details for d2ggba_

PDB Entry: 2ggb (more details), 2.13 Å

PDB Description: novel bacterial methionine aminopeptidase inhibitors
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2ggba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggba_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli K-12 [TaxId: 83333]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2ggba_:

Click to download the PDB-style file with coordinates for d2ggba_.
(The format of our PDB-style files is described here.)

Timeline for d2ggba_: