SCOPe 2.01: Domain d2gg8a_: 2gg8 A:

Lineage for d2gg8a_ (2gg8 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (6 species)

7. Species Escherichia coli K-12 [TaxId:83333] [187115] (9 PDB entries)

8. Domain d2gg8a_: 2gg8 A: [135124]
   automated match to d1mat__
   complexed with co, na, u15

Details for d2gg8a_

PDB Entry: 2gg8, 1.8 Å

PDB Description: Novel bacterial methionine aminopeptidase inhibitors

PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gg8a_:

Sequence; same for both SEQRES and ATOM records:

>d2gg8a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli K-12 [TaxId: 83333]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

Timeline for d2gg8a_:

• d2gg8a_ first appeared in SCOP 1.73, called d2gg8a1
  
• d2gg8a_ was called d2gg8a1 in SCOP 1.75
  
• d2gg8a_ appears in SCOPe 2.02
  
• d2gg8a_ appears in the current release, SCOPe 2.08