![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein Methionine aminopeptidase [55924] (7 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [187115] (9 PDB entries) |
![]() | Domain d2gg5a_: 2gg5 A: [135122] automated match to d1mat__ complexed with co, na, u19 |
PDB Entry: 2gg5 (more details), 2.12 Å
SCOPe Domain Sequences for d2gg5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gg5a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli K-12 [TaxId: 83333]} aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt dngceiltlrkddtipaiishde
Timeline for d2gg5a_: