Lineage for d2gg2a_ (2gg2 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. Protein Methionine aminopeptidase [55924] (7 species)
  7. Species Escherichia coli K-12 [TaxId:83333] [187115] (9 PDB entries)
  8. Domain d2gg2a_: 2gg2 A: [135120]
    automated match to d1mat__
    complexed with co, na, u12

Details for d2gg2a_

PDB Entry: 2gg2 (more details), 1 Å

PDB Description: Novel bacterial methionine aminopeptidase inhibitors
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gg2a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli K-12 [TaxId: 83333]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2gg2a_ are not available.

Timeline for d2gg2a_: