Lineage for d2gg0a_ (2gg0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581092Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2581093Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2581094Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2581143Protein Methionine aminopeptidase [55924] (6 species)
  7. 2581144Species Escherichia coli K-12 [TaxId:83333] [187115] (9 PDB entries)
  8. 2581149Domain d2gg0a_: 2gg0 A: [135118]
    automated match to d1mat__
    complexed with co, na, u11

Details for d2gg0a_

PDB Entry: 2gg0 (more details), 1.28 Å

PDB Description: Novel bacterial methionine aminopeptidase inhibitors
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gg0a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli K-12 [TaxId: 83333]}
isiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgy
hgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimg
erlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepq
vlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtd
ngceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2gg0a_:

Click to download the PDB-style file with coordinates for d2gg0a_.
(The format of our PDB-style files is described here.)

Timeline for d2gg0a_: