Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Methionine aminopeptidase [55924] (6 species) |
Species Escherichia coli K-12 [TaxId:83333] [187115] (9 PDB entries) |
Domain d2gg0a_: 2gg0 A: [135118] automated match to d1mat__ complexed with co, na, u11 |
PDB Entry: 2gg0 (more details), 1.28 Å
SCOPe Domain Sequences for d2gg0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gg0a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli K-12 [TaxId: 83333]} isiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgy hgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimg erlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepq vlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtd ngceiltlrkddtipaiishde
Timeline for d2gg0a_: