SCOPe 2.08: Domain d2gfxa2: 2gfx A:252-412

Lineage for d2gfxa2 (2gfx A:252-412)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase II, C-terminal domain [419017] (6 species)

7. Species Escherichia coli [TaxId:562] [419489] (4 PDB entries)

8. Domain d2gfxa2: 2gfx A:252-412 [135115]
   Other proteins in same PDB: d2gfxa1
   automated match to d1e5ma2
   complexed with pmn

Details for d2gfxa2

PDB Entry: 2gfx, 2.59 Å

PDB Description: structure of e. coli fabf(c163q) in complex with platensimycin

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d2gfxa2:

Sequence; same for both SEQRES and ATOM records:

>d2gfxa2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II, C-terminal domain {Escherichia coli [TaxId: 562]}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

Timeline for d2gfxa2:

• d2gfxa2 first appeared in SCOP 1.73
  
• d2gfxa2 appears in SCOPe 2.07