Lineage for d2gfxa1 (2gfx A:2-251)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881083Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1881242Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 1881243Species Escherichia coli [TaxId:562] [53910] (4 PDB entries)
  8. 1881246Domain d2gfxa1: 2gfx A:2-251 [135114]
    automated match to d1e5ma1
    complexed with pmn

Details for d2gfxa1

PDB Entry: 2gfx (more details), 2.59 Å

PDB Description: structure of e. coli fabf(c163q) in complex with platensimycin
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d2gfxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfxa1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]}
krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
mnggprkispffvpstivnmvaghltimyglrgpsisiataqtsgvhnighaariiaygd
advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
eyehakkrga

SCOPe Domain Coordinates for d2gfxa1:

Click to download the PDB-style file with coordinates for d2gfxa1.
(The format of our PDB-style files is described here.)

Timeline for d2gfxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gfxa2