Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (9 proteins) |
Protein Beta-ketoacyl-ACP synthase II [53909] (6 species) |
Species Escherichia coli [TaxId:562] [53910] (6 PDB entries) |
Domain d2gfxa1: 2gfx A:2-251 [135114] automated match to d1e5ma1 complexed with pmn |
PDB Entry: 2gfx (more details), 2.59 Å
SCOPe Domain Sequences for d2gfxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfxa1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl mnggprkispffvpstivnmvaghltimyglrgpsisiataqtsgvhnighaariiaygd advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle eyehakkrga
Timeline for d2gfxa1: