SCOP 1.73: Domain d2gfva1: 2gfv A:2-251

Lineage for d2gfva1 (2gfv A:2-251)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (8 proteins)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (5 species)

7. Species Escherichia coli [TaxId:562] [53910] (6 PDB entries)

8. Domain d2gfva1: 2gfv A:2-251 [135110]
   automatically matched to d1b3na1
   mutant

Details for d2gfva1

PDB Entry: 2gfv, 2.29 Å

PDB Description: structure of e. coli fabf (kasii) c163q mutant

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOP Domain Sequences for d2gfva1:

Sequence; same for both SEQRES and ATOM records:

>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]}
krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
mnggprkispffvpstivnmvaghltimyglrgpsisiataqtsgvhnighaariiaygd
advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
eyehakkrga

Timeline for d2gfva1:

• d2gfva1 is new in SCOP 1.73
  
• d2gfva1 appears in SCOP 1.75
  
• d2gfva1 appears in the current release, SCOPe 2.08