![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase II, N-terminal domain [419016] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [419488] (4 PDB entries) |
![]() | Domain d2gfva1: 2gfv A:2-251 [135110] Other proteins in same PDB: d2gfva2 automated match to d1e5ma1 mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2gfv (more details), 2.29 Å
SCOPe Domain Sequences for d2gfva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II, N-terminal domain {Escherichia coli [TaxId: 562]} krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl mnggprkispffvpstivnmvaghltimyglrgpsisiataqtsgvhnighaariiaygd advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle eyehakkrga
Timeline for d2gfva1: