![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.7: AF0625-like [142535] (1 family) ![]() contains extra C-terminal alpha/beta domain: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134 automatically mapped to Pfam PF04414 |
![]() | Family c.56.7.1: AF0625-like [142536] (2 proteins) Pfam PF04414; DUF516, binds magnesium ion and pyrophosphate in the putative active site |
![]() | Protein Hypothetical protein PH0006 [142537] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142538] (1 PDB entry) Uniprot O57774 1-274 |
![]() | Domain d2gfqc2: 2gfq C:1-274 [135108] Other proteins in same PDB: d2gfqa2, d2gfqa3, d2gfqb3, d2gfqb4, d2gfqc3, d2gfqc4 automated match to d2gfqa1 complexed with mg, so4 |
PDB Entry: 2gfq (more details), 1.75 Å
SCOPe Domain Sequences for d2gfqc2:
Sequence, based on SEQRES records: (download)
>d2gfqc2 c.56.7.1 (C:1-274) Hypothetical protein PH0006 {Pyrococcus horikoshii [TaxId: 53953]} mkvimttkvdkasmnimnklienfgfketeyvfegnpvykrgdvlilttndemiyydyld reienqlgfkpeiiafasrhsskqklpaltthvtgnwgkamyggkdesfavaipsamkls llkmselndlgwtvcyeathhgptelevpsffieigsseeewindrageiiaetiiyvld nyekgrskfkvalgiggghyapkqtkralegdlafghilpkyaqpvsrdvmikalnrfge kveaiyvdwkgsrgetrqlakslaqelglefikd
>d2gfqc2 c.56.7.1 (C:1-274) Hypothetical protein PH0006 {Pyrococcus horikoshii [TaxId: 53953]} mkvimttkvdkasmnimnklienfgfketeyvfegnpvykrgdvlilttndemiyydyld reienqlgfkpeiiafasrhsskqklpaltthvtgnwgkamyggkdesfavaipsamkls llkmselndlgwtvcyeathhgptelevpsffieigsseeewindrageiiaetiiyvld nyekgrsfkvalgiggghyapkqtkralegdlafghilpkyaqpvsrdvmikalnrfgek veaiyvdwkgsrgetrqlakslaqelglefikd
Timeline for d2gfqc2: