SCOPe 2.05: Domain d2gfqb_: 2gfq B:

Lineage for d2gfqb_ (2gfq B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.7: AF0625-like [142535] (1 family)
   contains extra C-terminal alpha/beta domain: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
   automatically mapped to Pfam PF04414

5. Family c.56.7.1: AF0625-like [142536] (2 proteins)
   Pfam PF04414; DUF516, binds magnesium ion and pyrophosphate in the putative active site

6. Protein Hypothetical protein PH0006 [142537] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142538] (1 PDB entry)
   Uniprot O57774 1-274

8. Domain d2gfqb_: 2gfq B: [135107]
   automated match to d2gfqa1
   complexed with mg, so4

Details for d2gfqb_

PDB Entry: 2gfq, 1.75 Å

PDB Description: Structure of Protein of Unknown Function PH0006 from Pyrococcus horikoshii

PDB Compounds: (B:) UPF0204 protein PH0006

SCOPe Domain Sequences for d2gfqb_:

Sequence; same for both SEQRES and ATOM records:

>d2gfqb_ c.56.7.1 (B:) Hypothetical protein PH0006 {Pyrococcus horikoshii [TaxId: 53953]}
yfqghmkvimttkvdkasmnimnklienfgfketeyvfegnpvykrgdvlilttndemiy
ydyldreienqlgfkpeiiafasrhsskqklpaltthvtgnwgkamyggkdesfavaips
amklsllkmselndlgwtvcyeathhgptelevpsffieigsseeewindrageiiaeti
iyvldnyekgrskfkvalgiggghyapkqtkralegdlafghilpkyaqpvsrdvmikal
nrfgekveaiyvdwkgsrgetrqlakslaqelglefikdg

Timeline for d2gfqb_:

• d2gfqb_ first appeared in SCOP 1.73, called d2gfqb1
  
• d2gfqb_ appears in SCOPe 2.04
  
• d2gfqb_ is called d2gfqb2 in SCOPe 2.06
  
• d2gfqb_ appears in the current release, SCOPe 2.08, called d2gfqb2