Lineage for d2gfqa1 (2gfq A:-11-274)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2890072Superfamily c.56.7: AF0625-like [142535] (1 family) (S)
    contains extra C-terminal alpha/beta domain: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
    automatically mapped to Pfam PF04414
  5. 2890073Family c.56.7.1: AF0625-like [142536] (2 proteins)
    Pfam PF04414; DUF516, binds magnesium ion and pyrophosphate in the putative active site
  6. 2890077Protein Hypothetical protein PH0006 [142537] (1 species)
  7. 2890078Species Pyrococcus horikoshii [TaxId:53953] [142538] (1 PDB entry)
    Uniprot O57774 1-274
  8. 2890079Domain d2gfqa1: 2gfq A:-11-274 [135106]
    Other proteins in same PDB: d2gfqa2, d2gfqa3, d2gfqb3, d2gfqb4, d2gfqc3, d2gfqc4
    complexed with mg, so4

Details for d2gfqa1

PDB Entry: 2gfq (more details), 1.75 Å

PDB Description: Structure of Protein of Unknown Function PH0006 from Pyrococcus horikoshii
PDB Compounds: (A:) UPF0204 protein PH0006

SCOPe Domain Sequences for d2gfqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfqa1 c.56.7.1 (A:-11-274) Hypothetical protein PH0006 {Pyrococcus horikoshii [TaxId: 53953]}
ssgrenlyfqghmkvimttkvdkasmnimnklienfgfketeyvfegnpvykrgdvlilt
tndemiyydyldreienqlgfkpeiiafasrhsskqklpaltthvtgnwgkamyggkdes
favaipsamklsllkmselndlgwtvcyeathhgptelevpsffieigsseeewindrag
eiiaetiiyvldnyekgrskfkvalgiggghyapkqtkralegdlafghilpkyaqpvsr
dvmikalnrfgekveaiyvdwkgsrgetrqlakslaqelglefikd

SCOPe Domain Coordinates for d2gfqa1:

Click to download the PDB-style file with coordinates for d2gfqa1.
(The format of our PDB-style files is described here.)

Timeline for d2gfqa1: