Lineage for d2gfoa1 (2gfo A:762-1109)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155259Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2155280Protein Ubiquitin carboxyl-terminal hydrolase 8 [142858] (1 species)
  7. 2155281Species Human (Homo sapiens) [TaxId:9606] [142859] (2 PDB entries)
    Uniprot P40818 762-1109
  8. 2155282Domain d2gfoa1: 2gfo A:762-1109 [135105]
    complexed with zn

Details for d2gfoa1

PDB Entry: 2gfo (more details), 2 Å

PDB Description: Structure of the Catalytic Domain of Human Ubiquitin Carboxyl-terminal Hydrolase 8
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 8

SCOPe Domain Sequences for d2gfoa1:

Sequence, based on SEQRES records: (download)

>d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]}
irnlnpvfggsgpaltglrnlgntcymnsilqclcnaphladyfnrncyqddinrsnllg
hkgevaeefgiimkalwtgqyryispkdfkitigkindqfagysqqdsqelllflmdglh
edlnkadnrkrykeenndhlddfkaaehawqkhkqlnesiivalfqgqfkstvqcltchk
ksrtfeafmylslplastskctlqdclrlfskeekltdnnrfycshcrarrdslkkieiw
klppvllvhlkrfsydgrwkqklqtsvdfplenldlsqyvigpknnlkkynlfsvsnhyg
gldgghytaycknaarqrwfkfddhevsdisvssvkssaayilfytsl

Sequence, based on observed residues (ATOM records): (download)

>d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]}
irnlnpvfggsgpaltglrnlgntcymnsilqclcnaphladyfnrncyqddinrsnllg
hkgevaeefgiimkalwtgqyryispkdfkitigkindqfagysqqdsqelllflmdglh
edlnkadndhlddfkaaehawqkhkqlnesiivalfqgqfkstvqcltchkksrtfeafm
ylslplastskctlqdclrlfskeekltdnnrfycshcrarrdslkkieiwklppvllvh
lkrfsydgrwkqklqtsvdfplenldlsqyvigpknnlkkynlfsvsnhyggldgghyta
ycknaarqrwfkfddhevsdisvssvkssaayilfytsl

SCOPe Domain Coordinates for d2gfoa1:

Click to download the PDB-style file with coordinates for d2gfoa1.
(The format of our PDB-style files is described here.)

Timeline for d2gfoa1: