SCOP 1.73: Domain d2gfnb2: 2gfn B:81-199

Lineage for d2gfnb2 (2gfn B:81-199)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins)

6. Protein Probable transcriptional regulator RHA1_ro04631 [140899] (1 species)

7. Species Rhodococcus sp. rha1 [TaxId:101510] [140900] (1 PDB entry)

8. Domain d2gfnb2: 2gfn B:81-199 [135104]
   Other proteins in same PDB: d2gfna1, d2gfnb1
   automatically matched to 2GFN A:81-199
   complexed with cl

Details for d2gfnb2

PDB Entry: 2gfn, 1.9 Å

PDB Description: crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1

PDB Compounds: (B:) HTH-type transcriptional regulator pksA related protein

SCOP Domain Sequences for d2gfnb2:

Sequence; same for both SEQRES and ATOM records:

>d2gfnb2 a.121.1.1 (B:81-199) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]}
agpieklrnitasilplderrlamtrvflffyaegaaeetargeiaaflarwrgvvresv
vaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrr

Timeline for d2gfnb2:

• d2gfnb2 is new in SCOP 1.73
  
• d2gfnb2 appears in SCOP 1.75
  
• d2gfnb2 appears in the current release, SCOPe 2.08