Lineage for d2gfna2 (2gfn A:81-199)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008294Protein Probable transcriptional regulator RHA1_ro04631 [140899] (1 species)
  7. 2008295Species Rhodococcus sp. RHA1 [TaxId:101510] [140900] (1 PDB entry)
    Uniprot Q0S7R9 81-199
  8. 2008296Domain d2gfna2: 2gfn A:81-199 [135102]
    Other proteins in same PDB: d2gfna1, d2gfnb1
    complexed with cl

Details for d2gfna2

PDB Entry: 2gfn (more details), 1.9 Å

PDB Description: crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1
PDB Compounds: (A:) HTH-type transcriptional regulator pksA related protein

SCOPe Domain Sequences for d2gfna2:

Sequence, based on SEQRES records: (download)

>d2gfna2 a.121.1.1 (A:81-199) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. RHA1 [TaxId: 101510]}
agpieklrnitasilplderrlamtrvflffyaegaaeetargeiaaflarwrgvvresv
vaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrr

Sequence, based on observed residues (ATOM records): (download)

>d2gfna2 a.121.1.1 (A:81-199) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. RHA1 [TaxId: 101510]}
agpieklrnitasilplderrlamtrvflffyaegtargeiaaflarwrgvvresvvaaq
regtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrr

SCOPe Domain Coordinates for d2gfna2:

Click to download the PDB-style file with coordinates for d2gfna2.
(The format of our PDB-style files is described here.)

Timeline for d2gfna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gfna1