Lineage for d2gfkb1 (2gfk B:24-317)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876592Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 876593Protein Zn metallo-beta-lactamase [56283] (10 species)
  7. 876661Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries)
  8. 876678Domain d2gfkb1: 2gfk B:24-317 [135100]
    automatically matched to d1smla_
    complexed with peg, sul, vii, zn

Details for d2gfkb1

PDB Entry: 2gfk (more details), 1.9 Å

PDB Description: crystal structure of the zinc-beta-lactamase l1 from stenotrophomonas maltophilia (inhibitor 2)
PDB Compounds: (B:) Metallo-beta-lactamase L1

SCOP Domain Sequences for d2gfkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfkb1 d.157.1.1 (B:24-317) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOP Domain Coordinates for d2gfkb1:

Click to download the PDB-style file with coordinates for d2gfkb1.
(The format of our PDB-style files is described here.)

Timeline for d2gfkb1: