Lineage for d2gfdb_ (2gfd B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2212983Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2212984Protein HSP90 [55876] (3 species)
  7. 2213027Species Dog (Canis familiaris) [TaxId:9615] [103225] (26 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 2213052Domain d2gfdb_: 2gfd B: [135095]
    automated match to d1u2oa_
    complexed with 1pe, pg4, rda

Details for d2gfdb_

PDB Entry: 2gfd (more details), 2.3 Å

PDB Description: grp94 in complex with the novel hsp90 inhibitor radamide
PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d2gfdb_:

Sequence, based on SEQRES records: (download)

>d2gfdb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstselig
qfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlke
easdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d2gfdb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtiagtseflnkmteaqstseligqfgvgf
ysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyl
eldtiknlvkkysqfinfpiyvwssktktvwdwelmn

SCOPe Domain Coordinates for d2gfdb_:

Click to download the PDB-style file with coordinates for d2gfdb_.
(The format of our PDB-style files is described here.)

Timeline for d2gfdb_:

Domains from other chains:
(mouse over for more information)
d2gfda_