Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families) |
Family b.34.9.1: Tudor domain [63749] (7 proteins) Pfam PF00567 |
Protein Jumonji domain-containing protein 2A [141203] (1 species) contains tandem repeat of two segment-swapped Tudor domains |
Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries) Uniprot O75164 897-955! Uniprot O75164 956-1011 |
Domain d2gfab2: 2gfa B:897-955 [135092] automatically matched to 2GF7 A:897-955 complexed with m3l |
PDB Entry: 2gfa (more details), 2.1 Å
SCOP Domain Sequences for d2gfab2:
Sequence, based on SEQRES records: (download)
>d2gfab2 b.34.9.1 (B:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg
>d2gfab2 b.34.9.1 (B:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsg
Timeline for d2gfab2: