SCOPe 2.08: Domain d2gfaa2: 2gfa A:897-955

Lineage for d2gfaa2 (2gfa A:897-955)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein Jumonji domain-containing protein 2A [141203] (1 species)
   contains tandem repeat of two segment-swapped Tudor domains

7. Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
   Uniprot O75164 897-955! Uniprot O75164 956-1011

8. Domain d2gfaa2: 2gfa A:897-955 [135090]
   automatically matched to 2GF7 A:897-955

Details for d2gfaa2

PDB Entry: 2gfa, 2.1 Å

PDB Description: double tudor domain complex structure

PDB Compounds: (A:) Jumonji domain-containing protein 2A

SCOPe Domain Sequences for d2gfaa2:

Sequence, based on SEQRES records:

>d2gfaa2 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

Sequence, based on observed residues (ATOM records):

>d2gfaa2 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivg

Timeline for d2gfaa2:

• d2gfaa2 first appeared in SCOP 1.73
  
• d2gfaa2 appears in SCOPe 2.07