Lineage for d2gfaa1 (2gfa A:956-1008)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665781Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 665782Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 665783Protein Jumonji domain-containing protein 2A [141203] (1 species)
    contains tandem repeat of two segment-swapped Tudor domains
  7. 665784Species Human (Homo sapiens) [TaxId:9606] [141204] (2 PDB entries)
  8. 665785Domain d2gfaa1: 2gfa A:956-1008 [135089]
    automatically matched to 2GF7 A:956-1011
    complexed with m3l

Details for d2gfaa1

PDB Entry: 2gfa (more details), 2.1 Å

PDB Description: double tudor domain complex structure
PDB Compounds: (A:) Jumonji domain-containing protein 2A

SCOP Domain Sequences for d2gfaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfaa1 b.34.9.1 (A:956-1008) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytlde

SCOP Domain Coordinates for d2gfaa1:

Click to download the PDB-style file with coordinates for d2gfaa1.
(The format of our PDB-style files is described here.)

Timeline for d2gfaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gfaa2