Lineage for d2gf7c2 (2gf7 C:897-955)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784519Protein Jumonji domain-containing protein 2A [141203] (1 species)
    contains tandem repeat of two segment-swapped Tudor domains
  7. 2784520Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
    Uniprot O75164 897-955! Uniprot O75164 956-1011
  8. 2784534Domain d2gf7c2: 2gf7 C:897-955 [135086]
    automated match to d2gf7a2
    complexed with so4

Details for d2gf7c2

PDB Entry: 2gf7 (more details), 2.2 Å

PDB Description: double tudor domain structure
PDB Compounds: (C:) Jumonji domain-containing protein 2A

SCOPe Domain Sequences for d2gf7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf7c2 b.34.9.1 (C:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

SCOPe Domain Coordinates for d2gf7c2:

Click to download the PDB-style file with coordinates for d2gf7c2.
(The format of our PDB-style files is described here.)

Timeline for d2gf7c2: