| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
| Protein Jumonji domain-containing protein 2A [141203] (1 species) contains tandem repeat of two segment-swapped Tudor domains |
| Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries) Uniprot O75164 897-955! Uniprot O75164 956-1011 |
| Domain d2gf7c1: 2gf7 C:956-1011 [135085] automated match to d2gf7a1 complexed with so4 |
PDB Entry: 2gf7 (more details), 2.2 Å
SCOPe Domain Sequences for d2gf7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf7c1 b.34.9.1 (C:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
Timeline for d2gf7c1: