Lineage for d2gf7b1 (2gf7 B:956-1011)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394117Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2394118Protein Jumonji domain-containing protein 2A [141203] (1 species)
    contains tandem repeat of two segment-swapped Tudor domains
  7. 2394119Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
    Uniprot O75164 897-955! Uniprot O75164 956-1011
  8. 2394130Domain d2gf7b1: 2gf7 B:956-1011 [135083]
    automated match to d2gf7a1
    complexed with so4

Details for d2gf7b1

PDB Entry: 2gf7 (more details), 2.2 Å

PDB Description: double tudor domain structure
PDB Compounds: (B:) Jumonji domain-containing protein 2A

SCOPe Domain Sequences for d2gf7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf7b1 b.34.9.1 (B:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp

SCOPe Domain Coordinates for d2gf7b1:

Click to download the PDB-style file with coordinates for d2gf7b1.
(The format of our PDB-style files is described here.)

Timeline for d2gf7b1: