SCOP 1.73: Domain d2gf7a2: 2gf7 A:897-955

Lineage for d2gf7a2 (2gf7 A:897-955)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families)

5. Family b.34.9.1: Tudor domain [63749] (7 proteins)
   Pfam PF00567

6. Protein Jumonji domain-containing protein 2A [141203] (1 species)
   contains tandem repeat of two segment-swapped Tudor domains

7. Species Human (Homo sapiens) [TaxId:9606] [141204] (2 PDB entries)

8. Domain d2gf7a2: 2gf7 A:897-955 [135082]
   complexed with so4

Details for d2gf7a2

PDB Entry: 2gf7, 2.2 Å

PDB Description: double tudor domain structure

PDB Compounds: (A:) Jumonji domain-containing protein 2A

SCOP Domain Sequences for d2gf7a2:

Sequence; same for both SEQRES and ATOM records:

>d2gf7a2 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

Timeline for d2gf7a2:

• d2gf7a2 is new in SCOP 1.73
  
• d2gf7a2 appears in SCOP 1.75
  
• d2gf7a2 appears in the current release, SCOPe 2.08