Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (32 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [187114] (1 PDB entry) |
Domain d2gf6c_: 2gf6 C: [135079] Other proteins in same PDB: d2gf6a1 automated match to d1s5ua_ complexed with ca, coa |
PDB Entry: 2gf6 (more details), 1.91 Å
SCOPe Domain Sequences for d2gf6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf6c_ d.38.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} yvfedvvriydtdaqgiahyaayyrfftntiekfikekvgipypivnenlwfviaeshai yhrpvklgdkltvllnpkilsnktikfefkvlkdgelttegyviqiainpkiwkstempk eimdk
Timeline for d2gf6c_: