SCOPe 2.08: Domain d2gf6c_: 2gf6 C:

Lineage for d2gf6c_ (2gf6 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [187114] (1 PDB entry)

8. Domain d2gf6c_: 2gf6 C: [135079]
   Other proteins in same PDB: d2gf6a1
   automated match to d1s5ua_
   complexed with ca, coa

Details for d2gf6c_

PDB Entry: 2gf6, 1.91 Å

PDB Description: crystal structure of a putative thioesterase (sso2295) from sulfolobus solfataricus at 1.91 a resolution

PDB Compounds: (C:) conserved hypothetical protein

SCOPe Domain Sequences for d2gf6c_:

Sequence; same for both SEQRES and ATOM records:

>d2gf6c_ d.38.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
yvfedvvriydtdaqgiahyaayyrfftntiekfikekvgipypivnenlwfviaeshai
yhrpvklgdkltvllnpkilsnktikfefkvlkdgelttegyviqiainpkiwkstempk
eimdk

Timeline for d2gf6c_:

• d2gf6c_ first appeared in SCOP 1.73, called d2gf6c1
  
• d2gf6c_ appears in SCOPe 2.07