SCOP 1.73: Domain d2gf6b1: 2gf6 B:1-134

Lineage for d2gf6b1 (2gf6 B:1-134)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.1: 4HBT-like [54638] (16 proteins)
   Pfam PF03061

6. Protein Hypothetical protein SSO2295 [143156] (1 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [143157] (1 PDB entry)

8. Domain d2gf6b1: 2gf6 B:1-134 [135078]
   automatically matched to 2GF6 A:1-134
   complexed with ca, coa

Details for d2gf6b1

PDB Entry: 2gf6, 1.91 Å

PDB Description: crystal structure of a putative thioesterase (sso2295) from sulfolobus solfataricus at 1.91 a resolution

PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d2gf6b1:

Sequence; same for both SEQRES and ATOM records:

>d2gf6b1 d.38.1.1 (B:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
menieyvfedvvriydtdaqgiahyaayyrfftntiekfikekvgipypivnenlwfvia
eshaiyhrpvklgdkltvllnpkilsnktikfefkvlkdgelttegyviqiainpkiwks
tempkeimdklsik

Timeline for d2gf6b1:

• d2gf6b1 is new in SCOP 1.73
  
• d2gf6b1 appears in SCOP 1.75
  
• d2gf6b1 appears in the current release, SCOPe 2.08, called d2gf6b_