Lineage for d2gf6a1 (2gf6 A:1-134)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858618Family d.38.1.1: 4HBT-like [54638] (18 proteins)
    Pfam PF03061
  6. 858658Protein Hypothetical protein SSO2295 [143156] (1 species)
  7. 858659Species Archaeon Sulfolobus solfataricus [TaxId:2287] [143157] (1 PDB entry)
    Uniprot Q97WD2 1-134
  8. 858660Domain d2gf6a1: 2gf6 A:1-134 [135077]
    complexed with ca, coa

Details for d2gf6a1

PDB Entry: 2gf6 (more details), 1.91 Å

PDB Description: crystal structure of a putative thioesterase (sso2295) from sulfolobus solfataricus at 1.91 a resolution
PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d2gf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
menieyvfedvvriydtdaqgiahyaayyrfftntiekfikekvgipypivnenlwfvia
eshaiyhrpvklgdkltvllnpkilsnktikfefkvlkdgelttegyviqiainpkiwks
tempkeimdklsik

SCOP Domain Coordinates for d2gf6a1:

Click to download the PDB-style file with coordinates for d2gf6a1.
(The format of our PDB-style files is described here.)

Timeline for d2gf6a1: